PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PSME_00036858-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pseudotsuga
Family MYB_related
Protein Properties Length: 498aa    MW: 55595.2 Da    PI: 6.7692
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PSME_00036858-RAgenomePRSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.91.7e-162269148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      rg+W++eEd ll ++++ +G g+W+t +++ g++R++k+c++rw +yl
  PSME_00036858-RA 22 RGPWSPEEDILLSQYIQAFGEGRWRTLPKKAGLKRCGKSCRLRWMNYL 69
                      89********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.5E-211371IPR009057Homeodomain-like
PROSITE profilePS5129422.8821773IPR017930Myb domain
SMARTSM007171.4E-132171IPR001005SANT/Myb domain
PfamPF002491.1E-142269IPR001005SANT/Myb domain
SuperFamilySSF466891.43E-202396IPR009057Homeodomain-like
CDDcd001672.25E-102469No hitNo description
Gene3DG3DSA:1.10.10.602.5E-67295IPR009057Homeodomain-like
SMARTSM007172374175IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 498 aa     Download sequence    Send to blast
MQENTKSMAV RTPCCSKIGL NRGPWSPEED ILLSQYIQAF GEGRWRTLPK KAGLKRCGKS  60
CRLRWMNYLR PDVKRGYISP EEEDLILRLH RLLGNSQGID PRTHKPLPES LIETSAKCNT  120
GTPENNDMTP RPSLHESHPL QPDQTEVITN KTMKKCPESV GTGLNKDQYT TNNHIGSNDV  180
HLPRKKHKPD NAVDLFRTGT LTQPPHVIAP PEAINYYEGM ADMIQWKSKS KGSHAMGSTD  240
HMTPFMFHDL FPSTIPLPFT ESEKGVSILQ VSSSTSVLNN LSININNESF DPGLLGHNRS  300
SYWMNNPVMN FDMPLNAITV PGSQVADLYG DYNGQIGHSA TPPTTKSEYN VLYEGNQLSN  360
PTLGVGNFDL SKMHRRHHHV QKEESFMLPA EANAAVANQA NNSSNVHHMG SMVANQANNI  420
SNVHHMGPIP PDANSDLYSS YFVDSIAHED LLNTNNTNNN LESSFATSTS QALQVRLEPE  480
TPNLSYDFWS LPQYHPYV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C2e-1320952599MYB TRANSFORMING PROTEIN
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13540.15e-43myb domain protein 5